Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DLL3 Protein, Cynomolgus, Recombinant (His)

Catalog No. TMPH-02424

DLL3 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is A0A2K5WSR4.

DLL3 Protein, Cynomolgus, Recombinant (His)

DLL3 Protein, Cynomolgus, Recombinant (His)

Catalog No. TMPH-02424
DLL3 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is A0A2K5WSR4.
Pack SizePriceAvailabilityQuantity
20 μg$17520 days
100 μg$37720 days
1 mg$2,86020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody, the EC 50 is 1.625-2.702 ng/mL.
Description
DLL3 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is A0A2K5WSR4.
Species
Cynomolgus
Expression System
HEK293 Cells
TagC-6xHis
Accession NumberA0A2K5WSR4
Amino Acid
AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQR
Construction
27-490 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight50.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.