Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00609

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 41.0 kDa and the accession number is P52061.

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO)

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00609
dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 41.0 kDa and the accession number is P52061.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 41.0 kDa and the accession number is P52061.
Species
E. coli
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberP52061
Synonyms
yggV,rdgB,Nucleoside-triphosphate pyrophosphatase (NTPase),Nucleoside-triphosphate diphosphatase,Non-standard purine NTP pyrophosphatase,Non-canonical purine NTP pyrophosphatase,Inosine triphosphate pyrophosphatase (ITPase),dITP/XTP pyrophosphatase,Deoxyribonucleoside triphosphate pyrophosphohydrolase
Amino Acid
MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG
Construction
1-197 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight41.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords