Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00609
Synonyms: dITP/XTP pyrophosphatase, ITPase, yggV, NTPase, rdgB

Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate.
Species E. coli
Expression System E. coli
Tag N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Accession Number P52061
Synonyms dITP/XTP pyrophosphatase, ITPase, yggV, NTPase, rdgB
Amino Acid MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-197 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 41.0 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions. To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

dITP/XTP pyrophosphatase Protein, E. coli, Recombinant (His & Myc & SUMO) dITP/XTP pyrophosphatase ITPase yggV NTPase rdgB recombinant recombinant-proteins proteins protein

 

CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.