Home Tools
Log in
Cart

DELTA-actitoxin-Aeq1a Protein, Acinetobacter baumannii, Recombinant (His & SUMO)

Catalog No. TMPH-00025
Synonyms: 1,2-CTD, catA, Catechol 1,2-dioxygenase

DELTA-actitoxin-Aeq1a Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 50.3 kDa and the accession number is P07773.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
DELTA-actitoxin-Aeq1a Protein, Acinetobacter baumannii, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description DELTA-actitoxin-Aeq1a Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 50.3 kDa and the accession number is P07773.
Species Acinetobacter baylyi
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number P07773
Synonyms 1,2-CTD, catA, Catechol 1,2-dioxygenase
Amino Acid MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV
Construction 1-311 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 50.3 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

DELTA-actitoxin-Aeq1a Protein, Acinetobacter baumannii, Recombinant (His & SUMO) 1,2-CTD catA Catechol 1,2-dioxygenase recombinant recombinant-proteins proteins protein

 

TargetMol