Defensin-like protein 1 Protein, Dahlia merckii, Recombinant (B2M & His) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Defensin-like protein 1 Protein, Dahlia merckii, Recombinant (B2M & His) is expressed in E. coli. |
Species | Dahlia merckii |
Expression System | E. coli |
Tag | N-terminal 6xHis-B2M-tagged |
Accession Number | P0C8Y4 |
Synonyms | DmAMP1, Defensin-like protein 1, Cysteine-rich antimicrobial protein 1, Defensin AMP1 |
Amino Acid | ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 1-50 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 19.5 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Defensin-like protein 1 Protein, Dahlia merckii, Recombinant (B2M & His) DmAMP1 Defensin-like protein 1 Cysteine-rich antimicrobial protein 1 Defensin AMP1 recombinant recombinant-proteins proteins protein