Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DEFB126 Protein, Pongo pygmaeus, Recombinant (GST)

Catalog No. TMPH-03148

DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244.

DEFB126 Protein, Pongo pygmaeus, Recombinant (GST)

DEFB126 Protein, Pongo pygmaeus, Recombinant (GST)

Catalog No. TMPH-03148
DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$59720 days
100 μg$84520 days
200 μg$1,19020 days
500 μg$1,95020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244.
Species
Pongo pygmaeus
Expression System
P. pastoris (Yeast)
TagN-GST
Accession NumberA4H244
Synonyms
Defensin, beta 126,DEFB126,Beta-defensin 126
Amino Acid
SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Construction
21-63 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight31.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords