Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: S-mephenytoin 4-hydroxylase, Cytochrome P-450MP, Cytochrome P450 PB-1, Cytochrome P450 MP-8, Cytochrome P450 MP-4, Cytochrome P450 2C9, CYPIIC9, CYP2C9, CYP2C10, Cholesterol 25-hydroxylase, (S)-limonene 7-monooxygenase, (S)-limonene 6-monooxygenase, (R)-limonene 6-monooxygenase


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $105 | 20 days | 20 days | |
| 10 µg | $169 | 20 days | 20 days | |
| 20 µg | $283 | 20 days | 20 days | |
| 50 µg | $428 | 20 days | 20 days | |
| 100 µg | $590 | 20 days | 20 days | |
| 200 µg | $913 | 20 days | 20 days | |
| 500 µg | $1,620 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CYP2C9 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P11712 |
| Amino Acid | MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG |
| Construction | 1-162 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | S-mephenytoin 4-hydroxylase, Cytochrome P-450MP, Cytochrome P450 PB-1, Cytochrome P450 MP-8, Cytochrome P450 MP-4, Cytochrome P450 2C9, CYPIIC9, CYP2C9, CYP2C10, Cholesterol 25-hydroxylase, (S)-limonene 7-monooxygenase, (S)-limonene 6-monooxygenase, (R)-limonene 6-monooxygenase |
| Research Background | A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and steroids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. Exhibits low catalytic activity for the formation of catechol estrogens from 17beta-estradiol (E2) and estrone (E1), namely 2-hydroxy E1 and E2. Catalyzes bisallylic hydroxylation and hydroxylation with double-bond migration of polyunsaturated fatty acids (PUFA). Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan. |
| Molecular Weight | 25.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.