CYP2C19 Protein, Human, Recombinant (His & Myc)

Name: CYP2C19 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01185
Rating: 4.5 (1 reviews)

(Synonyms: Mephenytoin 4-hydroxylase, Fenbendazole monooxygenase (4'-hydroxylating), Cytochrome P450-254C, Cytochrome P450-11A, Cytochrome P450 2C19, CYPIIC19, CYPIIC17, CYP2C19, (S)-limonene 7-monooxygenase, (S)-limonene 6-monooxygenase, (R)-limonene 6-monooxygenase) Copy Product Info

Synonyms: Mephenytoin 4-hydroxylase, Fenbendazole monooxygenase (4'-hydroxylating), Cytochrome P450-254C, Cytochrome P450-11A, Cytochrome P450 2C19, CYPIIC19, CYPIIC17, CYP2C19, (S)-limonene 7-monooxygenase, (S)-limonene 6-monooxygenase, (R)-limonene 6-monooxygenase

Catalog No. TMPH-01185 Copy Product Info

CYP2C19 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	-	In Stock
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:93%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CYP2C19 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P33261
Amino Acid	RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
Construction	26-490 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Mephenytoin 4-hydroxylase, Fenbendazole monooxygenase (4'-hydroxylating), Cytochrome P450-254C, Cytochrome P450-11A, Cytochrome P450 2C19, CYPIIC19, CYPIIC17, CYP2C19, (S)-limonene 7-monooxygenase, (S)-limonene 6-monooxygenase, (R)-limonene 6-monooxygenase
Research Background	A cytochrome P450 monooxygenase involved in the metabolism of polyunsaturated fatty acids (PUFA). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates PUFA specifically at the omega-1 position. Catalyzes the epoxidation of double bonds of PUFA. Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine. Hydroxylates fenbendazole at the 4' position.

Chemical Properties

Molecular Weight

60.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.