Shopping Cart
Remove All
Your shopping cart is currently empty
CRMP1 Protein, Human, Recombinant
(Synonyms: Unc-33-like phosphoprotein 3 (ULIP-3), ULIP3, Inactive dihydropyrimidinase, DRP-1, DPYSL1, Dihydropyrimidinase-related protein 1, CRMP1, Collapsin response mediator protein 1 (CRMP-1)) Copy Product InfoSynonyms: Unc-33-like phosphoprotein 3 (ULIP-3), ULIP3, Inactive dihydropyrimidinase, DRP-1, DPYSL1, Dihydropyrimidinase-related protein 1, CRMP1, Collapsin response mediator protein 1 (CRMP-1)
Catalog No. TMPH-01226 Copy Product Info
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis. CRMP1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 62.2 kDa and the accession number is Q14194.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $132 | 20 days | 20 days | |
| 10 μg | $217 | 20 days | 20 days | |
| 20 μg | $362 | 20 days | 20 days | |
| 50 μg | $479 | 20 days | 20 days | |
| 100 μg | $598 | 20 days | 20 days | |
| 200 μg | $856 | 20 days | 20 days | |
| 500 μg | $1,370 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis. CRMP1 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 62.2 kDa and the accession number is Q14194. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q14194 |
| Amino Acid | MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG |
| Construction | 1-572 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Unc-33-like phosphoprotein 3 (ULIP-3), ULIP3, Inactive dihydropyrimidinase, DRP-1, DPYSL1, Dihydropyrimidinase-related protein 1, CRMP1, Collapsin response mediator protein 1 (CRMP-1) |
| Research Background |
| Molecular Weight | 62.2 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: CRMP1 Protein, Human, Recombinant chemical structure | CRMP1 Protein, Human, Recombinant molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.