Shopping Cart
Remove All
Your shopping cart is currently empty
CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $89 | 20 days | 20 days | |
| 10 μg | $143 | 20 days | 20 days | |
| 20 μg | $237 | 20 days | 20 days | |
| 50 μg | $358 | 20 days | 20 days | |
| 100 μg | $490 | 20 days | 20 days | |
| 200 μg | $755 | 20 days | 20 days | |
| 500 μg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CORIN Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.0 kDa and the accession number is Q9Y5Q5. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q9Y5Q5 |
| Synonyms | Transmembrane protease serine 10,TMPRSS10,Pro-ANP-converting enzyme,Heart-specific serine proteinase ATC2,CRN,Corin,Atrial natriuretic peptide-converting enzyme |
| Amino Acid | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS |
| Construction | 1-110 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 16.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing. Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney.; has weaker endopeptidase activity compared to isoform 1. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.