Home Tools
Log in
Cart

CORIN Protein, Human, Recombinant (His)

Catalog No. TMPH-00986
Synonyms: TMPRSS10, Pro-ANP-converting enzyme, Heart-specific serine proteinase ATC2, Transmembrane protease serine 10, Corin, CRN, CORIN, Atrial natriuretic peptide-converting enzyme

CORIN Protein, Human, Recombinant (His) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CORIN Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 237.00
100 μg 20 days $ 446.00
1 mg 20 days $ 1,920.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description CORIN Protein, Human, Recombinant (His) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-terminal 6xHis-tagged
Accession Number Q9Y5Q5
Synonyms TMPRSS10, Pro-ANP-converting enzyme, Heart-specific serine proteinase ATC2, Transmembrane protease serine 10, Corin, CRN, CORIN, Atrial natriuretic peptide-converting enzyme
Amino Acid MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-110 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 16.0 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing. Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney.; has weaker endopeptidase activity compared to isoform 1.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CORIN Protein, Human, Recombinant (His) TMPRSS10 Pro-ANP-converting enzyme Heart-specific serine proteinase ATC2 Transmembrane protease serine 10 Corin CRN CORIN Atrial natriuretic peptide-converting enzyme recombinant recombinant-proteins proteins protein

 

TargetMol