Shopping Cart
- Remove All
Your shopping cart is currently empty
CHRNA1 Protein, Human, Recombinant (His & PDI) is expressed in Yeast. The accession number is P02708.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $96 | 20 days | |
| 10 μg | $156 | 20 days | |
| 20 μg | $259 | 20 days | |
| 50 μg | $369 | 20 days | |
| 100 μg | $487 | 20 days | |
| 200 μg | $739 | 20 days | |
| 500 μg | $1,290 | 20 days | |
| 1 mg | $1,980 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CHRNA1 Protein, Human, Recombinant (His & PDI) is expressed in Yeast. The accession number is P02708. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-PDI |
| Accession Number | P02708 |
| Synonyms | CHRNA1,CHNRA,ACHRA,Acetylcholine receptor subunit alpha |
| Amino Acid | SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL |
| Construction | 21-255 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 86.0 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 350 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.