Home Tools
Log in
Cart

Chitosanase Protein, Bacillus velezensis UCMB5033, Recombinant (His)

Catalog No. TMPH-00187

N/A. Chitosanase Protein, Bacillus velezensis UCMB5033, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.4 kDa and the accession number is S6FZ94.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Chitosanase Protein, Bacillus velezensis UCMB5033, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description N/A. Chitosanase Protein, Bacillus velezensis UCMB5033, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.4 kDa and the accession number is S6FZ94.
Species Bacillus velezensis UCMB5033
Expression System E. coli
Tag N-6xHis
Accession Number S6FZ94
Amino Acid AGLNKDQKRRAEQLTSIFENGKTEIQYGYVEALDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPELRRLAKDESDDISNLKGFASAWRSLGNDKAFRAAQDKVNDSLYYQPAMKRSENAGLKTALAKAVMYDTVIQHGDGDDPDSFYALIKRTNKKMGGSPKDGTDEKKWLNKFLDVRYDDLMNPSDEDTQDEWRESVARVDVFRDIVKEKNYNLNGPIHVRSSEYGNFTIQ
Construction 37-278 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 31.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol