Home Tools
Log in
Cart

Chitin deacetylase Protein, Amylomyces rouxii, Recombinant (His)

Catalog No. TMPH-00051
Synonyms: Chitin deacetylase, MrCDA, CDA

Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate. Chitin deacetylase Protein, Amylomyces rouxii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 49.9 kDa and the accession number is P50325.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Chitin deacetylase Protein, Amylomyces rouxii, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate. Chitin deacetylase Protein, Amylomyces rouxii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 49.9 kDa and the accession number is P50325.
Species Amylomyces rouxii
Expression System E. coli
Tag N-10xHis
Accession Number P50325
Synonyms Chitin deacetylase, MrCDA, CDA
Amino Acid DTSANYWQSFTSQINPKNISIPSIEQTSSIDPTQECAYYTPDASLFTFNASEWPSIWEVATTNGMNESAEFLSVYNSIDWTKAPNISVRTLDANGNLDTTGYNTATDPDCWWTATTCTSPKISDINDDISKCPEPETWGLTYDDGPNCSHNAFYDYLQEQKLKASMFYIGSNVVDWPYGAMRGVVDGHHIASHTWSHPQMTTKTNQEVLAEFYYTQKAIKLATGLTPRYWRPPYGDIDDRVRWIASQLGLTAVIWNLDTDDWSAGVTTTVEAVEQSYSDYIAMGTNGTFANSGNIVLTHEINTTMSLAVENLPKIISAYKQVIDVATCYNISHPYFEDYEWTNVLNGTKSSATASGSATSASASGGATTAAAHIQASTSGAMSVLPNLALISAFIATLLF
Construction 22-421 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 49.9 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Chitin deacetylase Protein, Amylomyces rouxii, Recombinant (His) Chitin deacetylase MrCDA CDA recombinant recombinant-proteins proteins protein

 

TargetMol