Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

CELA3B Protein, Human, Recombinant (His)

Name: CELA3B Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01097
Rating: 4.5 (1 reviews)

(Synonyms: Protease E, Elastase-3B, Elastase IIIB, ELA3B, Chymotrypsin-like elastase family member 3B, CELA3B) Copy Product Info

Synonyms: Protease E, Elastase-3B, Elastase IIIB, ELA3B, Chymotrypsin-like elastase family member 3B, CELA3B

Catalog No. TMPH-01097 Copy Product Info

Efficient protease with alanine specificity but only little elastolytic activity. CELA3B Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.3 kDa and the accession number is P08861.

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	-	In Stock
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:86% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Efficient protease with alanine specificity but only little elastolytic activity. CELA3B Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.3 kDa and the accession number is P08861.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P08861
Amino Acid	VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Construction	29-270 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Protease E, Elastase-3B, Elastase IIIB, ELA3B, Chymotrypsin-like elastase family member 3B, CELA3B
Research Background

Chemical Properties

Molecular Weight

32.3 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

ProteaseEElastaseIIIB

Related Tags: CELA3B Protein, Human, Recombinant (His) chemical structure | CELA3B Protein, Human, Recombinant (His) molecular weight