Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 231.00 | |
100 μg | 20 days | $ 437.00 | |
1 mg | 20 days | $ 1,870.00 |
Description | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
Species | Human |
Expression System | Yeast |
Tag | N-terminal 6xHis-tagged |
Accession Number | O75871 |
Synonyms | CEACAM4, CGM7, Carcinoembryonic antigen CGM7, CEA cell adhesion molecule 4, Non-specific cross-reacting antigen W236, Carcinoembryonic antigen-related cell adhesion molecule 4 |
Amino Acid | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 36-155 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 14.7 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CEACAM4 Protein, Human, Recombinant (His) CEACAM4 CGM7 Carcinoembryonic antigen CGM7 CEA cell adhesion molecule 4 Non-specific cross-reacting antigen W236 Carcinoembryonic antigen-related cell adhesion molecule 4 recombinant recombinant-proteins proteins protein