Home Tools
Log in
Cart

CEACAM4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01047
Synonyms: CEACAM4, CGM7, Carcinoembryonic antigen CGM7, CEA cell adhesion molecule 4, Non-specific cross-reacting antigen W236, Carcinoembryonic antigen-related cell adhesion molecule 4

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CEACAM4 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 231.00
100 μg 20 days $ 437.00
1 mg 20 days $ 1,870.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Species Human
Expression System Yeast
Tag N-terminal 6xHis-tagged
Accession Number O75871
Synonyms CEACAM4, CGM7, Carcinoembryonic antigen CGM7, CEA cell adhesion molecule 4, Non-specific cross-reacting antigen W236, Carcinoembryonic antigen-related cell adhesion molecule 4
Amino Acid FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 36-155 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 14.7 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CEACAM4 Protein, Human, Recombinant (His) CEACAM4 CGM7 Carcinoembryonic antigen CGM7 CEA cell adhesion molecule 4 Non-specific cross-reacting antigen W236 Carcinoembryonic antigen-related cell adhesion molecule 4 recombinant recombinant-proteins proteins protein

 

TargetMol