Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CEACAM4 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01047 Copy Product Info
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.

CEACAM4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01047
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.

CEACAM4 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8620 days20 days
10 μg$13820 days20 days
20 μg$23120 days20 days
50 μg$34820 days20 days
100 μg$48020 days20 days
200 μg$73320 days20 days
500 μg$1,29020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberO75871
Synonyms
Non-specific cross-reacting antigen W236,CGM7,Cell adhesion molecule CEACAM4,CEACAM4,Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4),Carcinoembryonic antigen CGM7
Amino Acid
FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Construction
36-155 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight14.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords