Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CEACAM4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01047

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.

CEACAM4 Protein, Human, Recombinant (His)

CEACAM4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01047
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.
Pack SizePriceAvailabilityQuantity
20 μg$23120 days
100 μg$48020 days
1 mg$1,98020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberO75871
Synonyms
Non-specific cross-reacting antigen W236,CGM7,Cell adhesion molecule CEACAM4,CEACAM4,Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4),Carcinoembryonic antigen CGM7
Amino Acid
FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Construction
36-155 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight14.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords