Shopping Cart
Remove All
Your shopping cart is currently empty
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $86 | 20 days | 20 days | |
| 10 μg | $138 | 20 days | 20 days | |
| 20 μg | $231 | 20 days | 20 days | |
| 50 μg | $348 | 20 days | 20 days | |
| 100 μg | $480 | 20 days | 20 days | |
| 200 μg | $733 | 20 days | 20 days | |
| 500 μg | $1,290 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | O75871 |
| Synonyms | Non-specific cross-reacting antigen W236,CGM7,Cell adhesion molecule CEACAM4,CEACAM4,Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4),Carcinoembryonic antigen CGM7 |
| Amino Acid | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG |
| Construction | 36-155 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 14.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.