CEACAM4 Protein, Human, Recombinant (E. coli, His)

Name: CEACAM4 Protein, Human, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-01046
Rating: 4.5 (1 reviews)

(Synonyms: Non-specific cross-reacting antigen W236, CGM7, Cell adhesion molecule CEACAM4, CEACAM4, Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4), Carcinoembryonic antigen CGM7) Copy Product Info

Synonyms: Non-specific cross-reacting antigen W236, CGM7, Cell adhesion molecule CEACAM4, CEACAM4, Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4), Carcinoembryonic antigen CGM7

Catalog No. TMPH-01046 Copy Product Info

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.7 kDa and the accession number is O75871.

CEACAM4 Protein, Human, Recombinant (E. coli, His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.7 kDa and the accession number is O75871.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	O75871
Amino Acid	FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Construction	36-155 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Non-specific cross-reacting antigen W236, CGM7, Cell adhesion molecule CEACAM4, CEACAM4, Carcinoembryonic antigen-related cell adhesion molecule 4 (CEA cell adhesion molecule 4), Carcinoembryonic antigen CGM7
Research Background	Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Chemical Properties

Molecular Weight

16.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

CGM 7CEACAM 4CEA cell adhesion molecule 4

Related Tags: CEACAM4 Protein, Human, Recombinant (E. coli, His) chemical structure | CEACAM4 Protein, Human, Recombinant (E. coli, His) molecular weight