Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CD93 Protein, Cynomolgus, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02422

CD93 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 60.2 kDa and the accession number is A0A2K5VH53.

CD93 Protein, Cynomolgus, Recombinant (His)

CD93 Protein, Cynomolgus, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02422
CD93 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 60.2 kDa and the accession number is A0A2K5VH53.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$4020 days20 days
10 μg$6220 days20 days
20 μg$9820 days20 days
50 μg$17820 days20 days
100 μg$28920 days20 days
200 μg$51320 days20 days
500 μg$1,08020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL.
Description
CD93 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 60.2 kDa and the accession number is A0A2K5VH53.
Species
Cynomolgus
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberA0A2K5VH53
Synonyms
CD93
Amino Acid
ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL
Construction
24-581 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight60.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords