Shopping Cart
Remove All
Your shopping cart is currently empty
CD93 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 60.2 kDa and the accession number is A0A2K5VH53.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $40 | 20 days | 20 days | |
| 10 μg | $62 | 20 days | 20 days | |
| 20 μg | $98 | 20 days | 20 days | |
| 50 μg | $178 | 20 days | 20 days | |
| 100 μg | $289 | 20 days | 20 days | |
| 200 μg | $513 | 20 days | 20 days | |
| 500 μg | $1,080 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody, the EC50 is 0.1669-0.3513 ng/mL. |
| Description | CD93 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 60.2 kDa and the accession number is A0A2K5VH53. |
| Species | Cynomolgus |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | A0A2K5VH53 |
| Synonyms | CD93 |
| Amino Acid | ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL |
| Construction | 24-581 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 60.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.