Shopping Cart
Remove All
Your shopping cart is currently empty
CD20 Protein-VLP, Mouse, Recombinant (His)
Catalog No. TMPH-04211 Copy Product Info
CD20 Protein-VLP, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19437.
CD20 Protein-VLP, Mouse, Recombinant (His)
Catalog No. TMPH-04211
Copy Product InfoCD20 Protein-VLP, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19437.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $275 | 20 days | 20 days | |
| 10 μg | $459 | 20 days | 20 days | |
| 20 μg | $776 | 20 days | 20 days | |
| 50 μg | $1,190 | 20 days | 20 days | |
| 100 μg | $1,700 | 20 days | 20 days | |
| 200 μg | $2,860 | 20 days | 20 days | |
| 500 μg | $5,680 | 20 days | 20 days | |
| 1 mg | $9,630 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | CD20 Protein-VLP, Mouse, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19437. |
| Species | Mouse |
| Expression System | HEK293 Cells |
| Tag | C-10xHis (This tag can be tested only under denaturing conditions) |
| Accession Number | P19437 |
| Synonyms | Ms4a2,Ms4a1,Membrane-spanning 4-domains subfamily A member 1,Lymphocyte antigen 44,Ly-44,Cd20,B-lymphocyte antigen CD20,B-cell differentiation antigen Ly-44 |
| Amino Acid | MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
| Construction | 1-291 aa |
| Protein Purity | The purity information is not available for VLPs proteins. |
| Molecular Weight | 33.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.