Home Tools
Log in
Cart

CD200 Protein, Human, Recombinant (His & SUMO)

Catalog No. TMPH-01818
Synonyms: MOX1, OX-2 membrane glycoprotein, MOX2, CD200

Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. CD200 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.4 kDa and the accession number is P41217.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CD200 Protein, Human, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 237.00
100 μg 20 days $ 446.00
1 mg 20 days $ 1,920.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. CD200 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.4 kDa and the accession number is P41217.
Species Human
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number P41217
Synonyms MOX1, OX-2 membrane glycoprotein, MOX2, CD200
Amino Acid QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Construction 31-232 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 35.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CD200 Protein, Human, Recombinant (His & SUMO) MOX1 OX-2 membrane glycoprotein MOX2 CD200 recombinant recombinant-proteins proteins protein

 

TargetMol