CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli. |
Species | Canine |
Expression System | E. coli |
Tag | N-terminal 6xHis-KSI-tagged |
Accession Number | Q95N01 |
Synonyms | CC chemokine TARC, Small-inducible cytokine A17, C-C motif chemokine 17, CCL17, Thymus and activation-regulated chemokine, TARC |
Amino Acid | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 24-99 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 23.9 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CCL17 Protein, Canine, Recombinant (His & KSI) CC chemokine TARC Small-inducible cytokine A17 C-C motif chemokine 17 CCL17 Thymus and activation-regulated chemokine TARC recombinant recombinant-proteins proteins protein