Home Tools
Log in
Cart

CCL17 Protein, Canine, Recombinant (His & KSI)

Catalog No. TMPH-00485
Synonyms: CC chemokine TARC, Small-inducible cytokine A17, C-C motif chemokine 17, CCL17, Thymus and activation-regulated chemokine, TARC

CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CCL17 Protein, Canine, Recombinant (His & KSI)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli.
Species Canine
Expression System E. coli
Tag N-terminal 6xHis-KSI-tagged
Accession Number Q95N01
Synonyms CC chemokine TARC, Small-inducible cytokine A17, C-C motif chemokine 17, CCL17, Thymus and activation-regulated chemokine, TARC
Amino Acid ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 24-99 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 23.9 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CCL17 Protein, Canine, Recombinant (His & KSI) CC chemokine TARC Small-inducible cytokine A17 C-C motif chemokine 17 CCL17 Thymus and activation-regulated chemokine TARC recombinant recombinant-proteins proteins protein

 

TargetMol