Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Accession Number | P49913 |
Synonyms | CAP18, Cathelicidin antimicrobial peptide, CAMP, FALL39, CAP-18, 18 kDa cationic antimicrobial protein, hCAP-18 |
Amino Acid | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 132-170 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 24.7 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) CAP18 Cathelicidin antimicrobial peptide CAMP FALL39 CAP-18 18 kDa cationic antimicrobial protein hCAP-18 recombinant recombinant-proteins proteins protein