Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-01058

Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913.

Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-01058

Pack Size	Price	Availability
5 μg	$75	20 days
10 μg	$119	20 days
20 μg	$198	20 days
50 μg	$297	20 days
100 μg	$427	20 days
200 μg	$658	20 days
500 μg	$1,170	20 days
1 mg	$1,830	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913.
Species	Human
Expression System	E. coli
Tag	N-10xHis-SUMO, C-Myc
Accession Number	P49913
Synonyms	FALL39,Cathelicidin antimicrobial peptide,CAP18,CAMP,18 kDa cationic antimicrobial protein (CAP-18;hCAP-18)
Amino Acid	FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Construction	132-170 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	24.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.