Shopping Cart
- Remove All
- Your shopping cart is currently empty
C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated is expressed in E. coli with N-MBP, C-6xHis-Avi. The accession number is P30993.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $142 | 20 days | |
10 μg | $235 | 20 days | |
20 μg | $392 | 20 days | |
50 μg | $493 | 20 days | |
100 μg | $589 | 20 days | |
200 μg | $847 | 20 days | |
500 μg | $1,370 | 20 days | |
1 mg | $1,980 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
Description | C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated is expressed in E. coli with N-MBP, C-6xHis-Avi. The accession number is P30993. |
Species | Mouse |
Expression System | E. coli |
Tag | N-MBP, C-6xHis-Avi |
Accession Number | P30993 |
Synonyms | CD88,C5r1,C5ar1,C5ar,C5a anaphylatoxin chemotactic receptor 1,C5a anaphylatoxin chemotactic receptor (C5a-R;C5aR) |
Amino Acid | QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV |
Construction | 306-351 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 52.8 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.