C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated

Catalog No. TMPH-04213

C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated is expressed in E. coli with N-MBP, C-6xHis-Avi. The accession number is P30993.

C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated

Catalog No. TMPH-04213

C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated is expressed in E. coli with N-MBP, C-6xHis-Avi. The accession number is P30993.

Pack Size	Price	Availability
5 μg	$142	20 days
10 μg	$235	20 days
20 μg	$392	20 days
50 μg	$493	20 days
100 μg	$589	20 days
200 μg	$847	20 days
500 μg	$1,370	20 days
1 mg	$1,980	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	C5AR1 Protein, Mouse, Recombinant (MBP & His-Avi), Biotinylated is expressed in E. coli with N-MBP, C-6xHis-Avi. The accession number is P30993.
Species	Mouse
Expression System	E. coli
Tag	N-MBP, C-6xHis-Avi
Accession Number	P30993
Synonyms	CD88,C5r1,C5ar1,C5ar,C5a anaphylatoxin chemotactic receptor 1,C5a anaphylatoxin chemotactic receptor (C5a-R;C5aR)
Amino Acid	QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
Construction	306-351 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	52.8 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.