Shopping Cart
- Remove All
- Your shopping cart is currently empty
C5a peptidase Protein, S. pyogenes M1, Recombinant is expressed in E. coli. The accession number is P58099.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $490 | 20 days | |
100 μg | $772 | 20 days | |
1 mg | $2,730 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | C5a peptidase Protein, S. pyogenes M1, Recombinant is expressed in E. coli. The accession number is P58099. |
Species | Streptococcus pyogenes serotype M1 |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P58099 |
Synonyms | scpA,SCP,C5a peptidase |
Amino Acid | KATIRDLNDPSQVKTLQEKAGKGAGTVVAVIDAGFDKNHEAWRLTDKTKARYQSKEDLEKAKKEHGITYGEWVNDKVAYYHDYSKDGKTAVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLLLMRVEIVNGLADYARNYAQAIIDAVNLGAKVINMSFGNAALAYANLPDETKKAFDYAKSKGVSIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAADSTLTVASYSPDKQLTETATVKTADQQDKEMPVLSTNRFEPNKAYDYAYANRGMKEDDFKDVKGKIALIERGDIDFKDKIANAKKAGAVGVLIYDNQDKGFPIELPNVDQMPAAFISRKDGLLLKENPQKTITFNATPKVLPTASGTKLSRFSSWGLTADGNIKPDIAAPGQDILSSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDEKAYFSPRQQGAGAVDAKKAS |
Construction | 99-581 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 52.3 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 400 mM Sucrose pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 17 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.