Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

C5a peptidase Protein, S. pyogenes M1, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04380

C5a peptidase Protein, S. pyogenes M1, Recombinant is expressed in E. coli. The accession number is P58099.

C5a peptidase Protein, S. pyogenes M1, Recombinant

C5a peptidase Protein, S. pyogenes M1, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04380
C5a peptidase Protein, S. pyogenes M1, Recombinant is expressed in E. coli. The accession number is P58099.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$17620 days20 days
10 μg$29220 days20 days
20 μg$49020 days20 days
50 μg$63320 days20 days
100 μg$77220 days20 days
200 μg$1,12020 days20 days
500 μg$1,86020 days20 days
1 mg$2,73020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
C5a peptidase Protein, S. pyogenes M1, Recombinant is expressed in E. coli. The accession number is P58099.
Species
Streptococcus pyogenes serotype M1
Expression System
E. coli
TagTag Free
Accession NumberP58099
Synonyms
scpA,SCP,C5a peptidase
Amino Acid
KATIRDLNDPSQVKTLQEKAGKGAGTVVAVIDAGFDKNHEAWRLTDKTKARYQSKEDLEKAKKEHGITYGEWVNDKVAYYHDYSKDGKTAVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLLLMRVEIVNGLADYARNYAQAIIDAVNLGAKVINMSFGNAALAYANLPDETKKAFDYAKSKGVSIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAADSTLTVASYSPDKQLTETATVKTADQQDKEMPVLSTNRFEPNKAYDYAYANRGMKEDDFKDVKGKIALIERGDIDFKDKIANAKKAGAVGVLIYDNQDKGFPIELPNVDQMPAAFISRKDGLLLKENPQKTITFNATPKVLPTASGTKLSRFSSWGLTADGNIKPDIAAPGQDILSSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDEKAYFSPRQQGAGAVDAKKAS
Construction
99-581 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight52.3 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 400 mM Sucrose pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 17 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.