Bovine viral diarrhea virus (strain SD-1) Genome polyprotein (E. coli, His)

Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteasomal degradation.; Packages viral RNA to form a viral nucleocapsid and thereby protects viral RNA. Plays also a role in transcription regulation. Protects the incoming virus against IFN-induced effectors.; Initial binding to target cell probably involves interaction of E(rns) with glycosaminoglycans.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; Plays an essential role in the virus replication cycle by acting as a viroporin. Forms ion conductive pores, which alters the cell permeability allowing the transport of ions and other small molecules. Forms a leader sequence to properly orient NS2 in the membrane.; Uncleaved NS2-3 is required for production of infectious virus.; Plays a role in the regulation of viral RNA replication.; Multifunctional protein that contains an N-terminal protease and a C-terminal helicase, playing essential roles in viral polyprotein processing and viral genome replication. The chymotrypsin-like serine protease activity utilizes NS4A as an essential cofactor and catalyzes the cleavage of the polyprotein leading to the release of NS4A, NS4B, NS5A, and NS5B. Interacts with NS5B to enhance RNA-dependent RNA polymerase activity.; Acts as a cofactor for the NS3 protease activity.; Induces a specific membrane alteration that serves as a scaffold for the virus replication complex.; Replicates the viral (+) and (-) genome.

Pack Size	Availability	Price/USD
20 μg	20 days	$ 360.00
100 μg	20 days	$ 678.00
1 mg	20 days	$ 2,300.00

Description

Species	BVDV
Expression System	E. coli
Tag	N-terminal 10xHis-tagged
Accession Number	Q01499
Synonyms	Genome polyprotein
Amino Acid	MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction	1-168 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	25.0 kDa (predicted)

Formulation	Tris-based buffer，50% glycerol
Reconstitution	A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage	Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping	In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background	Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteasomal degradation.; Packages viral RNA to form a viral nucleocapsid and thereby protects viral RNA. Plays also a role in transcription regulation. Protects the incoming virus against IFN-induced effectors.; Initial binding to target cell probably involves interaction of E(rns) with glycosaminoglycans.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; Plays an essential role in the virus replication cycle by acting as a viroporin. Forms ion conductive pores, which alters the cell permeability allowing the transport of ions and other small molecules. Forms a leader sequence to properly orient NS2 in the membrane.; Uncleaved NS2-3 is required for production of infectious virus.; Plays a role in the regulation of viral RNA replication.; Multifunctional protein that contains an N-terminal protease and a C-terminal helicase, playing essential roles in viral polyprotein processing and viral genome replication. The chymotrypsin-like serine protease activity utilizes NS4A as an essential cofactor and catalyzes the cleavage of the polyprotein leading to the release of NS4A, NS4B, NS5A, and NS5B. Interacts with NS5B to enhance RNA-dependent RNA polymerase activity.; Acts as a cofactor for the NS3 protease activity.; Induces a specific membrane alteration that serves as a scaffold for the virus replication complex.; Replicates the viral (+) and (-) genome.

Calculator

Reconstitution Calculator

Recombinant Proteins Dilute Calculator

Specific Activity Calculator

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

bottom

Bovine viral diarrhea virus (strain SD-1) Genome polyprotein (E. coli, His)

Calculator

Tech Support

Keywords