BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli with N-terminal 6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa. Accession number: F8UNN7
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli with N-terminal 6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa. Accession number: F8UNN7 |
Species | Acinetobacter baumannii |
Expression System | E. coli |
Tag | N-terminal 6xHis-SUMO-tagged |
Accession Number | F8UNN7 |
Synonyms | Class B carbapenemase NDM-1, NDM-1, NDM-1 metallo-beta-lactamase, Beta-lactamase NDM-1, blaNDM-1, Metallo-beta-lactamase |
Amino Acid | AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 164-222 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 22.0 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant (His & SUMO) Class B carbapenemase NDM-1 NDM-1 NDM-1 metallo-beta-lactamase Beta-lactamase NDM-1 blaNDM-1 Metallo-beta-lactamase recombinant recombinant-proteins proteins protein