Beta-lactamase TEM Protein, E. coli, Recombinant (His)

Name: Beta-lactamase TEM Protein, E. coli, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00586
Rating: 4.5 (1 reviews)

(Synonyms: TEM-8/CAZ-2, TEM-6, TEM-5, TEM-4, TEM-3, TEM-24/CAZ-6, TEM-2, TEM-16/CAZ-7, TEM-1, Penicillinase, IRT-4, blaT-6, blaT-5, blaT-4, blaT-3, bla, Beta-lactamase TEM) Copy Product Info

Synonyms: TEM-8/CAZ-2, TEM-6, TEM-5, TEM-4, TEM-3, TEM-24/CAZ-6, TEM-2, TEM-16/CAZ-7, TEM-1, Penicillinase, IRT-4, blaT-6, blaT-5, blaT-4, blaT-3, bla, Beta-lactamase TEM

Catalog No. TMPH-00586 Copy Product Info

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

Beta-lactamase TEM Protein, E. coli, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,230	20 days	20 days
500 μg	$1,980	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
Species	E. coli
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P62593
Amino Acid	HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Construction	24-286 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	TEM-8/CAZ-2, TEM-6, TEM-5, TEM-4, TEM-3, TEM-24/CAZ-6, TEM-2, TEM-16/CAZ-7, TEM-1, Penicillinase, IRT-4, blaT-6, blaT-5, blaT-4, blaT-3, bla, Beta-lactamase TEM
Research Background

Chemical Properties

Molecular Weight

30.9 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

β-lactamase TEMβlactamase TEMTEM8/CAZ2TEM6TEM5TEM4TEM3TEM24/CAZ6TEM2TEM16/CAZ7TEM1IRT4blaT6blaT5blaT4blaT3b-lactamase TEM

Related Tags: Beta-lactamase TEM Protein, E. coli, Recombinant (His) chemical structure | Beta-lactamase TEM Protein, E. coli, Recombinant (His) molecular weight