Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

BamA Protein, E. coli, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00699 Copy Product Info
BamA Protein, E. coli, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 30 kDa and the accession number is P0A940.

BamA Protein, E. coli, Recombinant (His)

Catalog No. TMPH-00699
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

BamA Protein, E. coli, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 30 kDa and the accession number is P0A940.

BamA Protein, E. coli, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$143-In Stock
10 μg$238-In Stock
20 μg$397-In Stock
50 μg$597-In Stock
100 μg$845-In Stock
200 μg$1,23020 days20 days
500 μg$1,98020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
BamA Protein, E. coli, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 30 kDa and the accession number is P0A940.
Species
E. coli
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberP0A940
Synonyms
yzzY,yzzN,yaeT,Outer membrane protein assembly factor BamA,Omp85,bamA
Amino Acid
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
Construction
175-424 aa
Protein Purity
> 85% as determined by SDS-PAGE.
BamA Protein, E. coli, Recombinant (His)
Molecular Weight30 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Part of the outer membrane protein assembly complex (Bam), which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. Efficient substrate folding and insertion into the outer membrane requires all 5 subunits. A lateral gate may open between the first and last strands of the BamA beta-barrel that allows substrate to insert into the outer membrane; comparison of the structures of complete and nearly complete Bam complexes show there is considerable movement of all 5 proteins.; (Microbial infection) Acts as a receptor for CdiA-EC93, the contact-dependent growth inhibition (CDI) effector of E.coli strain EC93; antibodies against extracellular epitopes decrease CDI. Its role in CDI is independent of the other Bam complex components. Is not the receptor for CdiA from E.coli strain 536 / UPEC, which does not have the same mode of toxicity as CdiA from strain EC93; the decreased expression of bamA101 in some experiments decreases the level of outer membrane proteins in general. Susceptibility to CdiA-EC93 is dependent on E.coli BamA; replacing BamA with the gene from S.typhimurium LT2, E.cloacae ATCC 13047 or D.dadantii 3937 renders cells resistant to CdiA-EC93. Cells with BamA from another bacteria no longer form CdiA-EC93-induced aggregates with EC93 cells. A chimera in which E.cloacae extracellular loops 6 and 7 are replaced with loops 6 and 7 from E.coli is susceptible to CdiA-EC93 and to CdiA-CT from strain 536 / UPEC.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords