Azurin Protein, Bordetella bronchiseptica, Recombinant (His & Myc)

Catalog No. TMPH-00204

Azurin Protein, Bordetella bronchiseptica, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.8 kDa and the accession number is P0A321.

Azurin Protein, Bordetella bronchiseptica, Recombinant (His & Myc)

Catalog No. TMPH-00204

Pack Size	Price	Availability
5 μg	$129	20 days
10 μg	$216	20 days
20 μg	$360	In Stock
50 μg	$543	20 days
100 μg	$745	20 days
200 μg	$1,070	20 days
500 μg	$1,730	20 days
1 mg	$2,530	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Azurin Protein, Bordetella bronchiseptica, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.8 kDa and the accession number is P0A321.
Species	Bordetella bronchiseptica
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P0A321
Synonyms	Azurin
Amino Acid	AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD
Construction	22-150 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	20.8 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.