Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $143 | In Stock | |
| 10 μg | $238 | In Stock | |
| 20 μg | $397 | In Stock | |
| 50 μg | $597 | In Stock | |
| 100 μg | $845 | In Stock | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. | 
| Description | Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321. | 
| Species | Bordetella bronchiseptica | 
| Expression System | P. pastoris (Yeast) | 
| Tag | N-6xHis | 
| Accession Number | P0A321 | 
| Synonyms | Azurin | 
| Amino Acid | AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD | 
| Construction | 22-150 aa | 
| Protein Purity | > 90% as determined by SDS-PAGE.  | 
| Molecular Weight | 15.8 kDa (predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | Tris-based buffer, 50% glycerol | 
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.