Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 397.00 | |
100 μg | 20 days | $ 769.00 |
Description | Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321. |
Species | Bordetella bronchiseptica |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P0A321 |
Synonyms | BB3856, Azurin |
Amino Acid | AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD |
Construction | 22-150 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 15.8 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Azurin Protein, Bordetella bronchiseptica, Recombinant (His) BB3856 Azurin recombinant recombinant-proteins proteins protein