Home Tools
Log in
Cart

Azurin Protein, Bordetella bronchiseptica, Recombinant (His)

Catalog No. TMPH-00205
Synonyms: BB3856, Azurin

Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Azurin Protein, Bordetella bronchiseptica, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 769.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description Azurin Protein, Bordetella bronchiseptica, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P0A321.
Species Bordetella bronchiseptica
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number P0A321
Synonyms BB3856, Azurin
Amino Acid AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD
Construction 22-150 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 15.8 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Azurin Protein, Bordetella bronchiseptica, Recombinant (His) BB3856 Azurin recombinant recombinant-proteins proteins protein

 

TargetMol