Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption. |
Species | Sus scrofa (Pig) |
Expression System | E. coli |
Tag | N-terminal 6xHis-SUMO-tagged |
Accession Number | P32307 |
Synonyms | AVPR2, Vasopressin V2 receptor, V2R, AVPR V2, Antidiuretic hormone receptor, Renal-type arginine vasopressin receptor |
Amino Acid | WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 292-370 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 24.7 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
AVPR2 Protein, Pig, Recombinant (His & SUMO) AVPR2 Vasopressin V2 receptor V2R AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor recombinant recombinant-proteins proteins protein