Home Tools
Log in
Cart

AVPR2 Protein, Pig, Recombinant (His & SUMO)

Catalog No. TMPH-03132
Synonyms: AVPR2, Vasopressin V2 receptor, V2R, AVPR V2, Antidiuretic hormone receptor, Renal-type arginine vasopressin receptor

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
AVPR2 Protein, Pig, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Species Sus scrofa (Pig)
Expression System E. coli
Tag N-terminal 6xHis-SUMO-tagged
Accession Number P32307
Synonyms AVPR2, Vasopressin V2 receptor, V2R, AVPR V2, Antidiuretic hormone receptor, Renal-type arginine vasopressin receptor
Amino Acid WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 292-370 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 24.7 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

AVPR2 Protein, Pig, Recombinant (His & SUMO) AVPR2 Vasopressin V2 receptor V2R AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor recombinant recombinant-proteins proteins protein

 

TargetMol