ATP6V0D1 Protein, Human, Recombinant (GST)

Name: ATP6V0D1 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-02310
Rating: 4.5 (1 reviews)

(Synonyms: V-type proton ATPase subunit d 1, VPATPD, V-ATPase subunit d 1, V-ATPase AC39 subunit (p39), V-ATPase 40 kDa accessory protein, Vacuolar proton pump subunit d 1, ATP6V0D1, ATP6D, 32 kDa accessory protein) Copy Product Info

Synonyms: V-type proton ATPase subunit d 1, VPATPD, V-ATPase subunit d 1, V-ATPase AC39 subunit (p39), V-ATPase 40 kDa accessory protein, Vacuolar proton pump subunit d 1, ATP6V0D1, ATP6D, 32 kDa accessory protein

Catalog No. TMPH-02310 Copy Product Info

ATP6V0D1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 67.3 kDa and the accession number is P61421.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ATP6V0D1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 67.3 kDa and the accession number is P61421.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P61421
Amino Acid	MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Construction	1-351 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	V-type proton ATPase subunit d 1, VPATPD, V-ATPase subunit d 1, V-ATPase AC39 subunit (p39), V-ATPase 40 kDa accessory protein, Vacuolar proton pump subunit d 1, ATP6V0D1, ATP6D, 32 kDa accessory protein
Research Background	Subunit of the integral membrane V0 complex of the lysosomal proton-transporting V-type ATPase (v-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium.

Chemical Properties

Molecular Weight

67.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.