Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ASAH1 Protein, Mouse, Recombinant (GST & His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02490 Copy Product Info
ASAH1 Protein, Mouse, Recombinant (GST & His & Myc) is expressed in E. coli expression system with N-10XHis-GST and C-Myc tag. The predicted molecular weight is 43.8 kDa and the accession number is Q9WV54.

ASAH1 Protein, Mouse, Recombinant (GST & His & Myc)

Catalog No. TMPH-02490
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

ASAH1 Protein, Mouse, Recombinant (GST & His & Myc) is expressed in E. coli expression system with N-10XHis-GST and C-Myc tag. The predicted molecular weight is 43.8 kDa and the accession number is Q9WV54.

ASAH1 Protein, Mouse, Recombinant (GST & His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
ASAH1 Protein, Mouse, Recombinant (GST & His & Myc) is expressed in E. coli expression system with N-10XHis-GST and C-Myc tag. The predicted molecular weight is 43.8 kDa and the accession number is Q9WV54.
Species
Mouse
Expression System
E. coli
TagN-10XHis-GST, C-Myc
Accession NumberQ9WV54
Synonyms
N-acylsphingosine amidohydrolase,N-acylethanolamine hydrolase ASAH1,Asah1,Asah,Acylsphingosine deacylase,Acid ceramidase,Acid CDase,ACDase,AC
Amino Acid
QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
Construction
19-141 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight43.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH. Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation. Has a higher catalytic efficiency towards C12-ceramides versus other ceramides. Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine. For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used. Has also an N-acylethanolamine hydrolase activity. By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes. Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis. By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords