ARPT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)

Catalog No. TMPH-03595

Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546.

ARPT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)

Catalog No. TMPH-03595

Pack Size	Price	Availability
5 μg	$143	20 days
10 μg	$238	20 days
20 μg	$397	20 days
50 μg	$597	20 days
100 μg	$845	20 days
200 μg	$1,230	20 days
500 μg	$1,980	20 days
1 mg	$2,970	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546.
Species	Streptococcus pyogenes
Expression System	P. pastoris (Yeast)
Tag	N-10xHis, C-Myc
Accession Number	P63546
Synonyms	apt,APRT,Adenine phosphoribosyltransferase
Amino Acid	MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Construction	1-172 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	22.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.