Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ARPT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03595

Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546.

ARPT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)

ARPT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03595
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$59720 days
100 μg$84520 days
200 μg$1,23020 days
500 μg$1,98020 days
1 mg$2,97020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546.
Species
Streptococcus pyogenes
Expression System
P. pastoris (Yeast)
TagN-10xHis, C-Myc
Accession NumberP63546
Synonyms
apt,APRT,Adenine phosphoribosyltransferase
Amino Acid
MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Construction
1-172 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight22.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.