ADIPOR1 Protein, Human, Recombinant

Name: ADIPOR1 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-03793
Rating: 4.5 (1 reviews)

(Synonyms: TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1) Copy Product Info

Synonyms: TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1

Catalog No. TMPH-03793 Copy Product Info

ADIPOR1 Protein, Human, Recombinant is expressed in in vitro E. coli expression system with Tag Free. The accession number is Q96A54.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$373	20 days	20 days
10 µg	$628	20 days	20 days
20 µg	$1,060	20 days	20 days
50 µg	$1,490	20 days	20 days
100 µg	$1,930	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	ADIPOR1 Protein, Human, Recombinant is expressed in in vitro E. coli expression system with Tag Free. The accession number is Q96A54.
Species	Human
Expression System	in vitro E. coli expression system
Tag	Tag Free
Accession Number	Q96A54
Amino Acid	EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Construction	89-375 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1

Chemical Properties

Molecular Weight

33.0 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.