Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ADIPOR1 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03793 Copy Product Info
ADIPOR1 Protein, Human, Recombinant is expressed in in vitro E. coli expression system with Tag Free. The accession number is Q96A54.

ADIPOR1 Protein, Human, Recombinant

Catalog No. TMPH-03793
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

ADIPOR1 Protein, Human, Recombinant is expressed in in vitro E. coli expression system with Tag Free. The accession number is Q96A54.

ADIPOR1 Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$37320 days20 days
10 μg$62820 days20 days
20 μg$1,06020 days20 days
50 μg$1,49020 days20 days
100 μg$1,93020 days20 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
ADIPOR1 Protein, Human, Recombinant is expressed in in vitro E. coli expression system with Tag Free. The accession number is Q96A54.
Species
Human
Expression System
in vitro E. coli expression system
TagTag Free
Accession NumberQ96A54
Synonyms
TESBP1A,Progestin and adipoQ receptor family member I,Progestin and adipoQ receptor family member 1,PAQR1,ADIPOR1,Adiponectin receptor protein 1
Amino Acid
EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Construction
89-375 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight33.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords