Home Tools
Log in
Cart

ADAMTS4 Protein, Human, Recombinant (GST)

Catalog No. TMPH-00867
Synonyms: ADAMTS-14, ADAM-TS 14, A disintegrin and metalloproteinase with thrombospondin motifs 14, ADAM-TS14

Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ADAMTS4 Protein, Human, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 237.00
100 μg 20 days $ 446.00
1 mg 20 days $ 1,920.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site.
Species Human
Expression System E. coli
Tag N-terminal GST-tagged
Accession Number O75173
Synonyms ADAMTS-14, ADAM-TS 14, A disintegrin and metalloproteinase with thrombospondin motifs 14, ADAM-TS14
Amino Acid FASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 213-319 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 39.0 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ADAMTS4 Protein, Human, Recombinant (GST) ADAMTS-14 ADAM-TS 14 A disintegrin and metalloproteinase with thrombospondin motifs 14 ADAM-TS14 recombinant recombinant-proteins proteins protein

 

TargetMol