Home Tools
Log in
Cart

3-phytase A Protein, Aspergillus niger, Recombinant (E. coli, His)

Catalog No. TMPH-00124
Synonyms: EC:3.1.3.-, EC:3.1.3.8, phyA, Phytase A, Myo-inositol hexakisphosphate phosphohydrolase A, Myo-inositol-hexaphosphate 3-phosphohydrolase A, Histidine acid phosphatase phyA

Catalyzes the hydrolysis of inorganic orthophosphate from phytate. 3-phytase A Protein, Aspergillus niger, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 52.8 kDa and the accession number is P34752.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
3-phytase A Protein, Aspergillus niger, Recombinant (E. coli, His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Catalyzes the hydrolysis of inorganic orthophosphate from phytate. 3-phytase A Protein, Aspergillus niger, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 52.8 kDa and the accession number is P34752.
Species Aspergillus niger
Expression System E. coli
Tag N-6xHis
Accession Number P34752
Synonyms EC:3.1.3.-, EC:3.1.3.8, phyA, Phytase A, Myo-inositol hexakisphosphate phosphohydrolase A, Myo-inositol-hexaphosphate 3-phosphohydrolase A, Histidine acid phosphatase phyA
Amino Acid ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
Construction 24-467 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 52.8 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

3-phytase A Protein, Aspergillus niger, Recombinant (E. coli, His) EC:3.1.3.- EC:3.1.3.8 phyA Phytase A Myo-inositol hexakisphosphate phosphohydrolase A Myo-inositol-hexaphosphate 3-phosphohydrolase A Histidine acid phosphatase phyA recombinant recombinant-proteins proteins protein

 

TargetMol