Shopping Cart
Remove All
Your shopping cart is currently empty
3-dehydroquinase Protein, Salmonella typhi, Recombinant (His)
Catalog No. TMPH-03469 Copy Product Info
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. 3-dehydroquinase Protein, Salmonella typhi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.6 kDa and the accession number is P24670.
3-dehydroquinase Protein, Salmonella typhi, Recombinant (His)
Catalog No. TMPH-03469
Copy Product InfoInvolved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. 3-dehydroquinase Protein, Salmonella typhi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.6 kDa and the accession number is P24670.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $238 | 20 days | 20 days | |
| 20 μg | $397 | 20 days | 20 days | |
| 50 μg | $597 | 20 days | 20 days | |
| 100 μg | $845 | 20 days | 20 days | |
| 200 μg | $1,190 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. 3-dehydroquinase Protein, Salmonella typhi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.6 kDa and the accession number is P24670. |
| Species | Salmonella typhi |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P24670 |
| Synonyms | Type I DHQase,Type I dehydroquinase (DHQ1),aroD,3-dehydroquinate dehydratase,3-dehydroquinase |
| Amino Acid | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
| Construction | 1-252 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 29.6 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Keywords
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.