IAP-1 Protein, Rat, Recombinant (His)

Name: IAP-1 Protein, Rat, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03320
Rating: 4.5 (1 reviews)

(Synonyms: Intestinal-type alkaline phosphatase 1, Intestinal alkaline phosphatase I (IAP-I), Intestinal alkaline phosphatase 1, IAP-1, Alpi) Copy Product Info

Synonyms: Intestinal-type alkaline phosphatase 1, Intestinal alkaline phosphatase I (IAP-I), Intestinal alkaline phosphatase 1, IAP-1, Alpi

Catalog No. TMPH-03320 Copy Product Info

Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$43	20 days	20 days
10 μg	$66	20 days	20 days
20 μg	$106	20 days	20 days
50 μg	$189	20 days	20 days
100 μg	$297	20 days	20 days
200 μg	$519	20 days	20 days
500 μg	$1,090	20 days	20 days
1 mg	$1,930	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH 10.0. The specific activity is >10370.37 U/mg.
Description	Alkaline phosphatase that can hydrolyze various phosphate compounds. IAP-1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 55.9 kDa and the accession number is P15693.
Species	Rat
Expression System	HEK293 Cells
Tag	N-10xHis
Accession Number	P15693
Amino Acid	VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Construction	21-511 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Intestinal-type alkaline phosphatase 1, Intestinal alkaline phosphatase I (IAP-I), Intestinal alkaline phosphatase 1, IAP-1, Alpi
Research Background

Chemical Properties

Molecular Weight

55.9 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

IAP-IIAPIIAP1

Related Tags: IAP-1 Protein, Rat, Recombinant (His) chemical structure | IAP-1 Protein, Rat, Recombinant (His) molecular weight