Shopping Cart
Remove All
Your shopping cart is currently empty
Bempegaldesleukin (NKTR-214) is a PEGylated interleukin-2 (IL-2) that functions as an immunostimulatory IL-2 proagent, acting as a CD122-preferential agonist of the IL-2 pathway. It can stimulate an antitumor immune response [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Bempegaldesleukin (NKTR-214) is a PEGylated interleukin-2 (IL-2) that functions as an immunostimulatory IL-2 proagent, acting as a CD122-preferential agonist of the IL-2 pathway. It can stimulate an antitumor immune response [1]. |
| In vitro | Bempegaldesleukin is an IL-2 prodrug that has been engineered to provide controlled, sustained, and preferential signaling through the IL-2 pathway, aiming to stimulate anti-tumor immune responses while minimizing toxicity [1]. |
| In vivo | Administering Bempegaldesleukin (0.8 mg/kg; i.v. for 7 days) combined with NKTR-262 significantly enhances survival rates in CD8+ T cell-dependent manner across two tumor models (CT26 and EMT6) [2]. |
| Synonyms | NKTR-214, BEMPEG |
| Cas No. | 1939126-74-5 |
| Sequence | {X}-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib) |
| Sequence Short | {X}-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.