Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ZNHIT3 Protein, Human, Recombinant (His)

Catalog No. TMPH-03779

ZNHIT3 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q15649.

ZNHIT3 Protein, Human, Recombinant (His)

ZNHIT3 Protein, Human, Recombinant (His)

Catalog No. TMPH-03779
ZNHIT3 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q15649.
Pack SizePriceAvailabilityQuantity
50 μg $850In Stock
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
ZNHIT3 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q15649.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ15649
Synonyms
ZNHIT3,Zinc finger HIT domain-containing protein 3,TRIP-3,TRIP3,Thyroid hormone receptor interactor 3,HNF-4a coactivator
Amino Acid
MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
Construction
1-155 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight24.5 kDa (Predicted); 30 kDa (reducing condition)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords