Shopping Cart
Remove All
Your shopping cart is currently empty
ZG16B Protein, Human, Recombinant (His)
Catalog No. TMPH-02329
ZG16B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 20.0 kDa and the accession number is Q96DA0.
ZG16B Protein, Human, Recombinant (His)
Catalog No. TMPH-02329
ZG16B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 20.0 kDa and the accession number is Q96DA0.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $50 | - | In Stock | |
| 10 μg | $79 | - | In Stock | |
| 20 μg | $127 | - | In Stock | |
| 50 μg | $225 | - | In Stock | |
| 100 μg | $350 | - | In Stock | |
| 200 μg | $633 | 20 days | 20 days | |
| 500 μg | $1,390 | 20 days | 20 days | |
| 1 mg | $2,550 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Select Batch
Resource Download
Product Information
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC 50 is 24.13-46.04 ng/mL. |
| Description | ZG16B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 20.0 kDa and the accession number is Q96DA0. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | Q96DA0 |
| Synonyms | Zymogen granule protein 16 homolog B,ZG16B,PAUF,Pancreatic adenocarcinoma up-regulated factor |
| Amino Acid | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR |
| Construction | 53-208 aa |
| Protein Purity | > 95% as determined by SDS-PAGE.  |
| Molecular Weight | 20.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.