ZG16B Protein, Human, Recombinant (His)

Name: ZG16B Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02329
Price: 50 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Zymogen granule protein 16 homolog B, ZG16B, PAUF, Pancreatic adenocarcinoma up-regulated factor) Copy Product Info

Synonyms: Zymogen granule protein 16 homolog B, ZG16B, PAUF, Pancreatic adenocarcinoma up-regulated factor

Catalog No. TMPH-02329 Copy Product Info

Purity: 95%

ZG16B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 20.0 kDa and the accession number is Q96DA0.

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	-	In Stock
10 µg	$79	-	In Stock
20 µg	$127	-	In Stock
50 µg	$225	-	In Stock
100 µg	$350	-	In Stock
200 µg	$633	20 days	20 days
500 µg	$1,390	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:95%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC 50 is 24.13-46.04 ng/mL.
Description	ZG16B Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 20.0 kDa and the accession number is Q96DA0.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	Q96DA0
Amino Acid	GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Construction	53-208 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Zymogen granule protein 16 homolog B, ZG16B, PAUF, Pancreatic adenocarcinoma up-regulated factor

Chemical Properties

Molecular Weight

20.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.