Shopping Cart
Remove All
Your shopping cart is currently empty
Zaire ebolavirus (strain Mayinga-76) Nucleoprotein/NP Protein (His)
(Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N), NP, Ebola NP (eNP)) Copy Product InfoSynonyms: Nucleoprotein, Nucleocapsid protein (Protein N), NP, Ebola NP (eNP)
Catalog No. TMPH-03731 Copy Product Info
Zaire ebolavirus (strain Mayinga-76) Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is P18272.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $143 | 20 days | 20 days | |
| 10 µg | $238 | 20 days | 20 days | |
| 20 µg | $397 | 20 days | 20 days | |
| 50 µg | $597 | 20 days | 20 days | |
| 100 µg | $845 | 20 days | 20 days | |
| 200 µg | $1,190 | 20 days | 20 days | |
| 500 µg | $1,950 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Zaire ebolavirus (strain Mayinga-76) Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is P18272. |
| Species | ZEBOV |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P18272 |
| Amino Acid | LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ |
| Construction | 488-739 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Nucleoprotein, Nucleocapsid protein (Protein N), NP, Ebola NP (eNP) |
| Research Background | Oligomerizes into helical capsid to encapsidate the viral genome, protecting it from nucleases and the cellular innate immune response. VP35 binds to and stabilizes monomeric NP, keeping it soluble. Upon virus replication, NP is recruited to bind cooperatively viral genomic RNA and VP35 is released. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. The nucleocapsid is helical with a pitch of 10.81 NP per turn and a diameter of about 22nm. Each NP binds to six nucleotides of viral genomic RNA, three being exposed to the solvant and three hidden into the nucleocapsid. Recruits also host PPP2R5C phosphatase to dephosphorylate VP30 and thereby promote viral transcription. Upon virion assembly and budding, NP binds to VP24 and possibly host STAU1. |
| Molecular Weight | 31.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Keywords
Preview
Related Tags: Zaire ebolavirus (strain Mayinga-76) Nucleoprotein/NP Protein (His) chemical structure | Zaire ebolavirus (strain Mayinga-76) Nucleoprotein/NP Protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.