Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

YTHDF2 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04537 Copy Product Info
YTHDF2 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y5A9.

YTHDF2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04537
Copy Product Info
TargetMol | SPR

YTHDF2 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y5A9.

YTHDF2 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$11620 days20 days
10 μg$189-In Stock
20 μg$317-In Stock
50 μg$44820 days20 days
100 μg$58820 days20 days
200 μg$91320 days20 days
500 μg$1,63020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
YTHDF2 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y5A9.
Species
Human
Expression System
E. coli
TagN-10xHis
Accession NumberQ9Y5A9
Synonyms
YTHDF2,YTH domain-containing family protein 2,Renal carcinoma antigen NY-REN-2,High-glucose-regulated protein 8,HGRG8,DF2,CLL-associated antigen KW-14
Amino Acid
SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Construction
2-579 aa
Protein Purity
> 85% as determined by SDS-PAGE.
YTHDF2 Protein, Human, Recombinant (His)
Molecular Weight68.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 174 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords