YTHDF2 Protein, Human, Recombinant (His)

Name: YTHDF2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04537
Rating: 4.5 (1 reviews)

(Synonyms: YTHDF2, YTH domain-containing family protein 2, Renal carcinoma antigen NY-REN-2, High-glucose-regulated protein 8, HGRG8, DF2, CLL-associated antigen KW-14) Copy Product Info

Synonyms: YTHDF2, YTH domain-containing family protein 2, Renal carcinoma antigen NY-REN-2, High-glucose-regulated protein 8, HGRG8, DF2, CLL-associated antigen KW-14

Catalog No. TMPH-04537 Copy Product Info

YTHDF2 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y5A9.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$116	20 days	20 days
10 µg	$189	-	In Stock
20 µg	$317	-	In Stock
50 µg	$448	20 days	20 days
100 µg	$588	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,630	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	YTHDF2 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9Y5A9.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q9Y5A9
Amino Acid	SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Construction	2-579 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	YTHDF2, YTH domain-containing family protein 2, Renal carcinoma antigen NY-REN-2, High-glucose-regulated protein 8, HGRG8, DF2, CLL-associated antigen KW-14

Chemical Properties

Molecular Weight

68.2 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 174 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.