Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

YopE Protein, Yersinia enterocolitica, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03717

Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.

YopE Protein, Yersinia enterocolitica, Recombinant (His)

YopE Protein, Yersinia enterocolitica, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03717
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
Pack SizePriceAvailabilityQuantity
5 μg$27620 days
10 μg$46320 days
20 μg$78020 days
50 μg$98720 days
100 μg$1,26020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
Species
Yersinia enterocolitica
Expression System
E. coli
TagN-6xHis
Accession NumberP31492
Synonyms
yopE,yop25,Outer membrane virulence protein YopE
Amino Acid
MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Construction
1-219 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords