Shopping Cart
Remove All
Your shopping cart is currently empty
YopE Protein, Yersinia enterocolitica, Recombinant (His)
Catalog No. TMPH-03717 Copy Product Info
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
YopE Protein, Yersinia enterocolitica, Recombinant (His)
Catalog No. TMPH-03717
Copy Product InfoEssential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $276 | 20 days | 20 days | |
| 10 μg | $463 | 20 days | 20 days | |
| 20 μg | $780 | 20 days | 20 days | |
| 50 μg | $987 | 20 days | 20 days | |
| 100 μg | $1,260 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis. |
| Species | Yersinia enterocolitica |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P31492 |
| Synonyms | yopE,yop25,Outer membrane virulence protein YopE |
| Amino Acid | MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM |
| Construction | 1-219 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 26.9 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Keywords
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.