YopE Protein, Yersinia enterocolitica, Recombinant (His)

Catalog No. TMPH-03717

Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.

YopE Protein, Yersinia enterocolitica, Recombinant (His)

Catalog No. TMPH-03717

Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.

Pack Size	Price	Availability
5 μg	$276	20 days
10 μg	$463	20 days
20 μg	$780	20 days
50 μg	$987	20 days
100 μg	$1,260	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
Species	Yersinia enterocolitica
Expression System	E. coli
Tag	N-6xHis
Accession Number	P31492
Synonyms	yopE,yop25,Outer membrane virulence protein YopE
Amino Acid	MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Construction	1-219 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	26.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.