Wnt7b Protein, Human, Recombinant (His & Myc)

Name: Wnt7b Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-04092
Rating: 4.5 (1 reviews)

(Synonyms: WNT7B, Protein Wnt-7b) Copy Product Info

Synonyms: WNT7B, Protein Wnt-7b

Catalog No. TMPH-04092 Copy Product Info

Wnt7b Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus Insect Cells with N-10xHis, C-Myc. The accession number is P56706.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$175	20 days	20 days
10 μg	$289	20 days	20 days
20 μg	$488	20 days	20 days
50 μg	$877	20 days	20 days
100 μg	$1,370	20 days	20 days
200 μg	$1,720	20 days	20 days
500 μg	$2,350	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	Wnt7b Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus Insect Cells with N-10xHis, C-Myc. The accession number is P56706.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	P56706
Amino Acid	ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Construction	25-349 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	WNT7B, Protein Wnt-7b

Chemical Properties

Molecular Weight

40.2 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Protein Wnt7b

Related Tags: Wnt7b Protein, Human, Recombinant (His & Myc) chemical structure | Wnt7b Protein, Human, Recombinant (His & Myc) molecular weight