Vaccinia virus (strain Copenhagen) OPG161 Protein (A33R, His) is expressed in Baculovirus.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 491.00 | |
100 μg | 20 days | $ 1,370.00 | |
500 μg | 20 days | $ 1,960.00 |
Description | Vaccinia virus (strain Copenhagen) OPG161 Protein (A33R, His) is expressed in Baculovirus. |
Species | VACV |
Expression System | Baculovirus |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | P68616 |
Amino Acid | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 57-185 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 18.3 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein