Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus OPG190 Protein (His)

TargetMol | SPR
Catalog No. TMPH-04372 Copy Product Info
Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.

Vaccinia virus OPG190 Protein (His)

Catalog No. TMPH-04372
Copy Product Info
TargetMol | SPR

Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.

Vaccinia virus OPG190 Protein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$58820 days20 days
10 μg$99220 days20 days
20 μg$1,68020 days20 days
50 μg$2,23020 days20 days
100 μg$2,80020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.
Species
Vaccinia virus
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ80KX4
Synonyms
Protein OPG190,Plaque-size/host range protein,B5R
Amino Acid
MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP
Construction
1-317 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight41.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 9 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.