Shopping Cart
Remove All
Your shopping cart is currently empty
This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $238 | 20 days | 20 days | |
| 20 μg | $397 | 20 days | 20 days | |
| 50 μg | $597 | 20 days | 20 days | |
| 100 μg | $845 | 20 days | 20 days | |
| 200 μg | $1,190 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948. |
| Species | UmV6 |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P16948 |
| Synonyms | KP6 killer toxin,Killer protein 6 |
| Amino Acid | NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS |
| Construction | 28-105 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 10.6 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.