This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 397.00 | |
100 μg | 20 days | $ 769.00 | |
500 μg | 20 days | $ 1,780.00 |
Description | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948. |
Species | UmV6 |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P16948 |
Amino Acid | NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS |
Construction | 28-105 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 10.6 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein