Shopping Cart
Remove All
Your shopping cart is currently empty
TSPO Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P50637.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $519 | 20 days | 20 days | |
| 10 μg | $875 | 20 days | 20 days | |
| 20 μg | $1,480 | 20 days | 20 days | |
| 50 μg | $1,980 | 20 days | 20 days | |
| 100 μg | $2,480 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | TSPO Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P50637. |
| Species | Mouse |
| Expression System | in vitro E. coli expression system |
| Tag | N-10xHis |
| Accession Number | P50637 |
| Synonyms | Tspo,Translocator protein,PKBS,Peripheral-type benzodiazepine receptor (PBR),Mitochondrial benzodiazepine receptor,Mbr,Bzrp |
| Amino Acid | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE |
| Construction | 1-169 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Molecular Weight | 21.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.