Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

TSPAN8 Protein-VLP, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04155 Copy Product Info
TSPAN8 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19075.

TSPAN8 Protein-VLP, Human, Recombinant (His)

Catalog No. TMPH-04155
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

TSPAN8 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19075.

TSPAN8 Protein-VLP, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$28920 days20 days
10 μg$483-In Stock
20 μg$81520 days20 days
50 μg$1,27020 days20 days
100 μg$1,79020 days20 days
200 μg$2,99020 days20 days
500 μg$5,89020 days20 days
1 mg$9,87020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description
TSPAN8 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19075.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis (This tag can be tested only under denaturing conditions)
Accession NumberP19075
Synonyms
Tumor-associated antigen CO-029,Tspan-8,TSPAN8,Transmembrane 4 superfamily member 3,TM4SF3,Tetraspanin-8
Amino Acid
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Construction
1-237 aa
Protein Purity
The purity information is not available for VLPs proteins.
Molecular Weight27.4 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords