Shopping Cart
Remove All
Your shopping cart is currently empty
TSPAN8 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19075.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $289 | 20 days | 20 days | |
| 10 μg | $483 | - | In Stock | |
| 20 μg | $815 | 20 days | 20 days | |
| 50 μg | $1,270 | 20 days | 20 days | |
| 100 μg | $1,790 | 20 days | 20 days | |
| 200 μg | $2,990 | 20 days | 20 days | |
| 500 μg | $5,890 | 20 days | 20 days | |
| 1 mg | $9,870 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control. |
| Description | TSPAN8 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P19075. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis (This tag can be tested only under denaturing conditions) |
| Accession Number | P19075 |
| Synonyms | Tumor-associated antigen CO-029,Tspan-8,TSPAN8,Transmembrane 4 superfamily member 3,TM4SF3,Tetraspanin-8 |
| Amino Acid | MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK |
| Construction | 1-237 aa |
| Protein Purity | The purity information is not available for VLPs proteins. |
| Molecular Weight | 27.4 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.