Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

TMEM106B Protein, Mouse, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04350

TMEM106B Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q80X71.

TMEM106B Protein, Mouse, Recombinant (His)

TMEM106B Protein, Mouse, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04350
TMEM106B Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q80X71.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12320 days20 days
10 μg$19820 days20 days
20 μg$33820 days20 days
50 μg$48820 days20 days
100 μg$64620 days20 days
200 μg$99820 days20 days
500 μg$1,78020 days20 days
1 mg$2,76020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
TMEM106B Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q80X71.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberQ80X71
Synonyms
Transmembrane protein 106B,Tmem106b
Amino Acid
PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ
Construction
119-275 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight19.6 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.