TMEM106B Protein, Mouse, Recombinant (His)

Name: TMEM106B Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04350
Rating: 4.5 (1 reviews)

(Synonyms: Transmembrane protein 106B, Tmem106b) Copy Product Info

Synonyms: Transmembrane protein 106B, Tmem106b

Catalog No. TMPH-04350 Copy Product Info

TMEM106B Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q80X71.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$123	20 days	20 days
10 µg	$198	20 days	20 days
20 µg	$338	20 days	20 days
50 µg	$488	20 days	20 days
100 µg	$646	20 days	20 days
200 µg	$998	20 days	20 days
500 µg	$1,780	20 days	20 days
1 mg	$2,760	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	TMEM106B Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with C-6xHis. The accession number is Q80X71.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	Q80X71
Amino Acid	PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ
Construction	119-275 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Transmembrane protein 106B, Tmem106b

Chemical Properties

Molecular Weight

19.6 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.